Protein Info for KEDOAH_26640 in Escherichia coli ECRC99

Name: ldhA
Annotation: D-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 5 to 328 (324 residues), 121.6 bits, E=2.8e-39
• PF02826: 2-Hacid_dh_C
  • amino acids 110 to 297 (188 residues), 173.1 bits, E=5.7e-55
• PF03446: NAD_binding_2
  • amino acids 148 to 259 (112 residues), 21 bits, E=4.4e-08

Best Hits

Swiss-Prot: 100% identical to LDHD_ECOLI: D-lactate dehydrogenase (ldhA) from Escherichia coli (strain K12)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to eco:b1380)

MetaCyc: 100% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (17/17 steps found)
• mixed acid fermentation (16/16 steps found)
• heterolactic fermentation (16/18 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• L-alanine degradation II (to D-lactate) (2/3 steps found)
• vancomycin resistance I (2/3 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (5/8 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (2/6 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.28

Use Curated BLAST to search for 1.1.1.28

Protein Sequence (329 amino acids)

>KEDOAH_26640 D-lactate dehydrogenase (Escherichia coli ECRC99)
MKLAVYSTKQYDKKYLQQVNESFGFELEFFDFLLTEKTAKTANGCEAVCIFVNDDGSRPV
LEELKKHGVKYIALRCAGFNNVDLDAAKELGLKVVRVPAYDPEAVAEHAIGMMMTLNRRI
HRAYQRTRDANFSLEGLTGFTMYGKTAGVIGTGKIGVAMLRILKGFGMRLLAFDPYPSAA
ALELGVEYVDLPTLFSESDVISLHCPLTPENYHLLNEAAFDQMKNGVMIVNTSRGALIDS
QAAIEALKNQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSACHNVLFTGHQAFLT
AEALTSISQTTLQNLSNLEKGETCPNELV