Protein Info for KEDOAH_25640 in Escherichia coli ECRC99

Name: oppD
Annotation: murein tripeptide/oligopeptide ABC transporter ATP-binding protein OppD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00005: ABC_tran" amino acids 39 to 197 (159 residues), 107.3 bits, see alignment E=1.6e-34 PF13304: AAA_21" amino acids 163 to 232 (70 residues), 27.6 bits, see alignment E=4.2e-10 PF08352: oligo_HPY" amino acids 248 to 312 (65 residues), 78.9 bits, see alignment E=4.5e-26 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 248 to 330 (83 residues), 84.9 bits, see alignment E=1.6e-28

Best Hits

Swiss-Prot: 99% identical to OPPD_ECOLI: Oligopeptide transport ATP-binding protein OppD (oppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to eoj:ECO26_1757)

MetaCyc: 99% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>KEDOAH_25640 murein tripeptide/oligopeptide ABC transporter ATP-binding protein OppD (Escherichia coli ECRC99)
MSVIETATVPLAQQQADALLNVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGS
GKSQTAFALMGLLAANGRIGGSATFNGREILNLPERELNKLRAEQISMIFQDPMTSLNPY
MRVGEQLMEVLMLHKNMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIA
MALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLGVVAGICDKVL
VMYAGRTMEYGNARDVFYQPVHPYSIGLLNAVPRLDAEGETMLTIPGNPPNLLRLPKGCP
FQPRCPHAMEICSSAPPLEEFTPGRLRACFKPVEELL