Protein Info for KEDOAH_25290 in Escherichia coli ECRC99

Name: nhaB
Annotation: Na(+)/H(+) antiporter NhaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 20 to 49 (30 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 92 to 117 (26 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 299 to 331 (33 residues), see Phobius details amino acids 350 to 369 (20 residues), see Phobius details amino acids 389 to 413 (25 residues), see Phobius details amino acids 452 to 471 (20 residues), see Phobius details amino acids 478 to 500 (23 residues), see Phobius details TIGR00774: Na+/H+ antiporter NhaB" amino acids 1 to 512 (512 residues), 1025.1 bits, see alignment E=0 PF06450: NhaB" amino acids 1 to 511 (511 residues), 1017.4 bits, see alignment E=0 PF03600: CitMHS" amino acids 70 to 339 (270 residues), 72.3 bits, see alignment E=4.2e-24

Best Hits

Swiss-Prot: 100% identical to NHAB_ECOHS: Na(+)/H(+) antiporter NhaB (nhaB) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K03314, Na+:H+ antiporter, NhaB family (inferred from 100% identity to eco:b1186)

MetaCyc: 100% identical to Na+:H+ antiporter NhaB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-130

Predicted SEED Role

"Na+/H+ antiporter NhaB" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>KEDOAH_25290 Na(+)/H(+) antiporter NhaB (Escherichia coli ECRC99)
MEISWGRALWRNFLGQSPDWYKLALIIFLIVNPLIFLISPFVAGWLLVAEFIFTLAMALK
CYPLLPGGLLAIEAVFIGMTSAEHVREEVAANLEVLLLLMFMVAGIYFMKQLLLFIFTRL
LLSIRSKMLLSLSFCVAAAFLSAFLDALTVVAVVISVAVGFYGIYHRVASSRTEDTDLQD
DSHIDKHYKVVLEQFRGFLRSLMMHAGVGTALGGVMTMVGEPQNLIIAKAAGWHFGDFFL
RMSPVTVPVLICGLLTCLLVEKLRWFGYGETLPEKVREVLQQFDDQSRHQRTRQDKIRLI
VQAIIGVWLVTALALHLAEVGLIGLSVIILATSLTGVTDEHAIGKAFTESLPFTALLTVF
FSVVAVIIDQQLFSPIIQFVLQASEHAQLSLFYIFNGLLSSISDNVFVGTIYINEAKAAM
ESGAITLKQYELLAVAINTGTNLPSVATPNGQAAFLFLLTSALAPLIRLSYGRMVWMALP
YTLVLTLVGLLCVEFTLAPVTEWFMQMGWIATL