Protein Info for KEDOAH_25265 in Escherichia coli ECRC99

Name: hlyE
Annotation: hemolysin HlyE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 83 to 100 (18 residues), see Phobius details amino acids 177 to 201 (25 residues), see Phobius details PF06109: HlyE" amino acids 4 to 293 (290 residues), 487.8 bits, see alignment E=9.3e-151

Best Hits

Swiss-Prot: 100% identical to HLYE_ECO57: Hemolysin E (hlyE) from Escherichia coli O157:H7

KEGG orthology group: K11139, hemolysin E (inferred from 99% identity to eco:b1182)

Predicted SEED Role

"Hemolysin E, chromosomal"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>KEDOAH_25265 hemolysin HlyE (Escherichia coli ECRC99)
MTEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASV
LVGNIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVL
DDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAG
AAAGVVAGPFGLIISYSIAAGVVEGKLIPELKNKLKSVQSFFTTLSNTVKQANKDIDAAK
LKLTTEIAAIGEIKTETETTRFYVDYDDLMLSLLKEAANKMINTCNEYQKRHGKKTLFEV
PEV