Protein Info for KEDOAH_25035 in Escherichia coli ECRC99

Annotation: tail assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 69 to 95 (27 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details PF06805: Lambda_tail_I" amino acids 1 to 64 (64 residues), 67.7 bits, see alignment E=4.9e-23

Best Hits

Swiss-Prot: 98% identical to TIPI_LAMBD: Tail tip assembly protein I (I) from Escherichia phage lambda

KEGG orthology group: None (inferred from 96% identity to ssn:SSON_2413)

Predicted SEED Role

"Phage tail assembly protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (190 amino acids)

>KEDOAH_25035 tail assembly protein (Escherichia coli ECRC99)
VKTGAEAIRALATQLPVFRQKLSDGWYQVRITGRDVSTSGLTAQLHETLPDGAVIHIVPR
VAGAKSGGVFQIVLGAAAIAGSFFTAGATLAAWGAAIGAGGITGILFSLGASMVLGGVAQ
MLAPKARTPRTQTTDNGKQNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEG
DGGQVVVIGR