Protein Info for KEDOAH_24095 in Escherichia coli ECRC99

Name: flgE
Annotation: flagellar hook protein FlgE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 TIGR03506: flagellar hook-basal body protein" amino acids 1 to 383 (383 residues), 324 bits, see alignment E=9.2e-101 PF00460: Flg_bb_rod" amino acids 6 to 33 (28 residues), 29.8 bits, see alignment (E = 9.2e-11) PF22692: LlgE_F_G_D1" amino acids 76 to 145 (70 residues), 46.3 bits, see alignment E=7.9e-16 PF07559: FlgE_D2" amino acids 157 to 282 (126 residues), 82.6 bits, see alignment E=8.2e-27 PF06429: Flg_bbr_C" amino acids 356 to 400 (45 residues), 60 bits, see alignment 2.6e-20

Best Hits

Swiss-Prot: 95% identical to FLGE_ECOLI: Flagellar hook protein FlgE (flgE) from Escherichia coli (strain K12)

KEGG orthology group: K02390, flagellar hook protein FlgE (inferred from 100% identity to etw:ECSP_1377)

Predicted SEED Role

"Flagellar hook protein FlgE" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>KEDOAH_24095 flagellar hook protein FlgE (Escherichia coli ECRC99)
MAFSQAVSGLNAAATNLDVIGNNIANSATYGFKSGTASFADMFAGSKVGLGVKVAGITQD
FTDGTTTNTGRGLDVAISQNGFFRLVDSNGSVFYSRNGQFKLDENRNLVNMQGLQLTGYP
ATGTPPTIQQGANPTNISIPNTLMAAKTTTTASMQINLNSSDPLPSVNAFDASNADSYNK
KGSVTVFDSQGNAHDMSVYFVKTGDNNWQVYTQDSSDPTGTAEPAMKLVFNANGVLTSNP
TENITTGAINGAEPATFSLSFLNSMQQNTGANNIVATTQNGYKPGDLVSYQINDDGTVVG
NYSNEQTQLLGQIVLANFANNEGLASEGDNVWSATQSSGVALLGTAGTGNFGTLTNGALE
ASNVDLSKELVNMIVAQRNYQSNAQTIKTQDQILNTLVNLR