Protein Info for KEDOAH_23435 in Escherichia coli ECRC99

Name: ureF
Annotation: Urease accessory protein UreF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01730: UreF
  • amino acids 38 to 181 (144 residues), 118 bits, E=2.3e-38

Best Hits

Swiss-Prot: 100% identical to UREF_ECO57: Urease accessory protein UreF (ureF1) from Escherichia coli O157:H7

KEGG orthology group: K03188, urease accessory protein (inferred from 100% identity to eoi:ECO111_1231)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

• superpathway of allantoin degradation in plants (7/8 steps found)
• urea degradation II (1/1 steps found)

Protein Sequence (224 amino acids)

>KEDOAH_23435 Urease accessory protein UreF (Escherichia coli ECRC99)
MPTPEKRLRLMQLASNSLPVGGYSWSQGLEWAVEAGWVEDSAAFEHWQQLQMEQSFFAVD
LPLLARLYRACEAGDPDSAGRWTAYLLACRETRELRDEERNRGAAFTRLLVDWQPDCPAE
WRKLCQQSQLTGMAWLGVRWQISVSDLALSLGYSWIESAVMAGVRLVPYGQLAAQQLIMR
LCARYAANMDSALATPDHAIGSATPLASIASARHETQYSRLFRS