Protein Info for KEDOAH_22990 in Escherichia coli ECRC99

Name: gfcE
Annotation: Putative polysaccharide export protein GfcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF02563: Poly_export" amino acids 81 to 165 (85 residues), 87.3 bits, see alignment E=1.2e-28 PF22461: SLBB_2" amino acids 171 to 249 (79 residues), 86.8 bits, see alignment E=1.7e-28 amino acids 256 to 342 (87 residues), 82.9 bits, see alignment E=2.9e-27 PF10531: SLBB" amino acids 173 to 222 (50 residues), 34.8 bits, see alignment 2.4e-12 amino acids 256 to 311 (56 residues), 22.8 bits, see alignment 1.3e-08 PF18412: Wza_C" amino acids 345 to 374 (30 residues), 56.3 bits, see alignment (E = 4.2e-19)

Best Hits

Swiss-Prot: 100% identical to GFCE_ECOLI: Putative polysaccharide export protein GfcE (gfcE) from Escherichia coli (strain K12)

KEGG orthology group: K01991, polysaccharide export outer membrane protein (inferred from 100% identity to eco:b0983)

MetaCyc: 64% identical to outer membrane polysaccharide export protein Wza (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Putative polysaccharide export protein YccZ precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>KEDOAH_22990 Putative polysaccharide export protein GfcE (Escherichia coli ECRC99)
MKKNIFKFSVLTLAVLSLTACTLVPGQNLSTSNKDVIELPDNQYDLDKMVNIYPVTPGLI
DQLRAKPIMSQANPELEQQIANYEYRIGIGDVLMVTVWDHPELTTPAGQYRSASDTGNWV
NADGAIFYPYIGRLKVAGKTLTQVRNEITARLDSVIESPQVDVSVAAFRSQKAYVTGEVS
KSGQQPITNIPLTIMDAINAAGGLTADADWRNVVLTQNGVKTKVNLYALMQRGDLRQNKL
LHPGDILFIPRNDDLKVFVMGEVGKQSTLKMDRSGMTLAEALGNAEGMNQDVADATGIFV
IRATQNKQNGKIANIYQLNAKDASAMILGTEFQLEPYDIVYVTTAPLARWNRVISLLVPT
ISGVHDLTETSRWIQTWPN