Protein Info for KEDOAH_22820 in Escherichia coli ECRC99

Name: gpA1
Annotation: Phage terminase, large subunit GpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 PF05876: GpA_ATPase" amino acids 1 to 179 (179 residues), 117 bits, see alignment E=1.2e-37 PF20454: GpA_nuclease" amino acids 210 to 487 (278 residues), 242.8 bits, see alignment E=4.8e-76

Best Hits

Swiss-Prot: 96% identical to TERL_BPP21: Terminase, large subunit gp2 (2) from Enterobacteria phage P21

KEGG orthology group: None (inferred from 100% identity to etw:ECSP_2602)

Predicted SEED Role

"Phage terminase, large subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>KEDOAH_22820 Phage terminase, large subunit GpA (Escherichia coli ECRC99)
MKSHVEATIRNVPCLKDLSPWLGRKHRDNTLTLKRFSSGVGFWCLGGAAAKNYREKSVDV
VCYDELSSFEPDVEKEGSPTLLGDKRIEGSVWPKSIRGSTPKIKGTCQIEKAANESAHFM
RFYVPCPHCGEAQYLKFGDESTPFGLKWEKDSPESVFYLCEHHGCVIHQSELDQSNGRWI
CENTGMWTRDGLTFFSARGDEIPPPRSIMFHIWTAYSPFTTWVQIVYDWLDALKDPNGLK
TFVNTTLGETWEEAVGEKLDHQVLMDKVVRYTAAVPARVVYLTAGIDSQRNRFEMYVWGW
APGEEAFLVDKIIIMGRPDEEETLLRVDAAINKKYRHADGTEMTISRVCWDTGGIDGEIV
YQRSKKHGVFRVLPVKGASVYGKPVITMPKTRNQRGVYLCEVGTDTAKEILYARMKADPS
PADEATSYAIRFPDDPEIFSQTEAQQLVAEELVEKWEKGKMRLLWDNKKRRNEALDCLVY
AYAALRVSVQRWQLDLAVLAKSREEETTRPTLKELAAKLSGGVNGYSR