Protein Info for KEDOAH_21885 in Escherichia coli ECRC99

Annotation: Chloramphenicol resistance pump Cmr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 122 to 138 (17 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 208 to 225 (18 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 314 (279 residues), 62.3 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: K08160, MFS transporter, DHA1 family, multidrug/chloramphenicol efflux transport protein (inferred from 99% identity to sbo:SBO_0738)

Predicted SEED Role

"Multidrug translocase MdfA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>KEDOAH_21885 Chloramphenicol resistance pump Cmr (Escherichia coli ECRC99)
LGSYFDDRVSGGRDVFTMAPGAVVGSYWSPSGDAGGCGVVWFIVTCLAILLAQNIEQFTL
LRFLQGISLCFIGAVGYAAIQESFEEAVCIKITALMANVALIAPLLGPLVGAAWIHVLPW
EGMFVLFAALAAISFFGLQRAMPETATRIGEKLSLKELGRDYKLVLKNGRFVAGALALGF
VSLPLLAWIAQSPIIIITGEQLSSYEYGLLQVPIFGALIAGNLLLARLTSRRTVRSLIIM
GGWPIMIGLLVAAAATVISSHAYLWMTAGLSIYAFGIGLANAGLVRLTLFASDMSKGTVS
AAMGMLQMLIFTVGIEISKHAWLNGGNGLFNLFNLVNGILWLSLMVIFLKDKQMGNSHEG