Protein Info for KEDOAH_20705 in Escherichia coli ECRC99

Name: gltK
Annotation: glutamate/aspartate ABC transporter permease GltK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 118 (106 residues), 82.4 bits, see alignment E=1.4e-27 PF00528: BPD_transp_1" amino acids 34 to 223 (190 residues), 66.7 bits, see alignment E=1.2e-22

Best Hits

Swiss-Prot: 100% identical to GLTK_ECOL6: Glutamate/aspartate import permease protein GltK (gltK) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10002, glutamate/aspartate transport system permease protein (inferred from 100% identity to eco:b0653)

MetaCyc: 100% identical to glutamate/aspartate ABC transporter membrane subunit GltK (Escherichia coli K-12 substr. MG1655)
ABC-13-RXN [EC: 7.4.2.1]; 7.4.2.1 [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate Aspartate transport system permease protein GltK (TC 3.A.1.3.4)" (TC 3.A.1.3.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>KEDOAH_20705 glutamate/aspartate ABC transporter permease GltK (Escherichia coli ECRC99)
MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYV
NVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI
QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF
FRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA