Protein Info for KEDOAH_20375 in Escherichia coli ECRC99

Name: fepG
Annotation: iron-enterobactin ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 62 to 81 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 237 to 263 (27 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details PF01032: FecCD" amino acids 20 to 324 (305 residues), 291.9 bits, see alignment E=2.5e-91

Best Hits

Swiss-Prot: 99% identical to FEPG_ECOLI: Ferric enterobactin transport system permease protein FepG (fepG) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 99% identity to eco:b0589)

MetaCyc: 99% identical to ferric enterobactin ABC transporter membrane subunit FepG (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin transport system permease protein FepG (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>KEDOAH_20375 iron-enterobactin ABC transporter permease (Escherichia coli ECRC99)
MIYVSRRLLITCLLLISACVVAGIWGLRSGAVTLEISQVFAALMGDAPRSMTMVVTEWRL
PRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGVLVAMVLFGQDLTAIAL
AAMVGGIITSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNTWLLLKASLETALTAGLW
NAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDDTACALGVSVERSRLLMML
VAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQAALCGALLLLAADLCAQQLF
MPYQLPVGVVTVSLGGIYLIVLLIQESRKK