Protein Info for KEDOAH_20145 in Escherichia coli ECRC99

Name: ppiB
Annotation: peptidylprolyl isomerase B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF00160: Pro_isomerase" amino acids 1 to 162 (162 residues), 170.7 bits, see alignment E=1.4e-54

Best Hits

Swiss-Prot: 99% identical to PPIB_ECOLI: Peptidyl-prolyl cis-trans isomerase B (ppiB) from Escherichia coli (strain K12)

KEGG orthology group: K03768, peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC: 5.2.1.8] (inferred from 99% identity to eco:b0525)

MetaCyc: 99% identical to peptidyl-prolyl cis-trans isomerase B (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiB (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>KEDOAH_20145 peptidylprolyl isomerase B (Escherichia coli ECRC99)
MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMK
QKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGY
CVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVSE