Protein Info for KEDOAH_20130 in Escherichia coli ECRC99

Name: purK
Annotation: 5-(carboxyamino)imidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 3 to 329 (327 residues), 390.5 bits, see alignment E=4.5e-121 PF02222: ATP-grasp" amino acids 88 to 254 (167 residues), 193.7 bits, see alignment E=1.9e-61 PF17769: PurK_C" amino acids 280 to 329 (50 residues), 60.4 bits, see alignment 1.1e-20

Best Hits

Swiss-Prot: 99% identical to PURK_ECOLI: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Escherichia coli (strain K12)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to ecf:ECH74115_0623)

MetaCyc: 99% identical to 5-(carboxyamino)imidazole ribonucleotide synthase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide synthase. [EC: 6.3.4.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>KEDOAH_20130 5-(carboxyamino)imidazole ribonucleotide synthase (Escherichia coli ECRC99)
MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTR
ELARHPAFVNRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFERLGELAIVK
RRTGGYDGRGQWRLRADETEQLPAECYGECIVEQGINFSGEVSLVGARCFDGSTVFYPLT
HNLHQDGILRTSVAFPQANAQQQAQAEEMLSAIMQELGYVGVMAMECFVTPQGLLINELA
PRVHNSGHWTQNGASISQFELHLRAITDLPLPQPVVNNPSVMINLIGSDVNYDWLKLPLV
HLHWYDKEVRPGRKVGHLNLTDSDTSRLSATLEALIPLLPPEYASGVMWAQSKFC