Protein Info for KEDOAH_19135 in Escherichia coli ECRC99
Name: cynS
Annotation: cyanase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYNS_ECOLU: Cyanate hydratase (cynS) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 99% identity to eco:b0340)MetaCyc: 99% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]
Predicted SEED Role
"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)
MetaCyc Pathways
- allantoin degradation IV (anaerobic) (8/9 steps found)
- uracil degradation III (5/5 steps found)
- L-citrulline degradation (3/3 steps found)
- cyanate degradation (3/3 steps found)
- L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
- urea degradation I (2/3 steps found)
- superpathway of allantoin degradation in yeast (4/6 steps found)
- cyanuric acid degradation II (3/5 steps found)
- cyanuric acid degradation I (2/5 steps found)
- superpathway of atrazine degradation (3/8 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.1.104
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (156 amino acids)
>KEDOAH_19135 cyanase (Escherichia coli ECRC99) MIQSQINRNIRLDLADAILLSKAKKDLSFAEIADGTGLAEAFVTAALLGQQALPADAARQ VGAKLDLDEDAILLLQMIPLRGCIDDRIPTDPTMYRFYEMLQVYGTTLKALVHEKFGDGI ISAINFKLDVKKVADPEGGERAVITLDGKYLPTKPF