Protein Info for KEDOAH_18870 in Escherichia coli ECRC99

Name: lutC
Annotation: lactate utilization protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF02589: LUD_dom" amino acids 65 to 228 (164 residues), 108.7 bits, see alignment E=1.6e-35

Best Hits

Swiss-Prot: 99% identical to YKGG_ECOLI: Uncharacterized protein YkgG (ykgG) from Escherichia coli (strain K12)

KEGG orthology group: K00782, hypothetical protein (inferred from 99% identity to eco:b0308)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, hypothetical protein subunit YkgG" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>KEDOAH_18870 lactate utilization protein C (Escherichia coli ECRC99)
MDNRGEFLNNVAQALGRPLRLEPQAEDAPLNNYANERLTQLNQQQRCDAFIQFASDVMLT
RCELTSEAKAAEAAIRLCKELGDQSVVISGDTRLEELGISERLQQECNAVVWDPAKGAKN
ISQAEQAKVGVVYAEYGLTESGGVVLFSAAERGRSLSLLPESSLFILRKSTILPRVAQLA
ERLHQKAQAGERMPSCINIISGPSSTADIELIKVVGVHGPVKAVYLIIEDC