Protein Info for KEDOAH_18835 in Escherichia coli ECRC99

Name: glxA
Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 64 to 80 (17 residues), see Phobius details PF12833: HTH_18" amino acids 27 to 106 (80 residues), 67.1 bits, see alignment E=2.1e-22 PF00165: HTH_AraC" amino acids 70 to 105 (36 residues), 34.7 bits, see alignment 2.2e-12 PF06445: GyrI-like" amino acids 127 to 283 (157 residues), 48.4 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: None (inferred from 96% identity to ecp:ECP_0368)

Predicted SEED Role

"Transcriptional regulator YkgA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>KEDOAH_18835 AraC family transcriptional regulator (Escherichia coli ECRC99)
MIRQKILQQLLEWIECNLEHPISIEDIAQKSGYSRRNIQLLFRNFMHVPLGEYIRKRRLC
RAAILVRLTAKSMLDIAISLHFDSQQSFSREFKKLFGCSPRVYRHRDYWDLANIFPSFLI
RQQQKTECRLVNFPETPIFGNSFKYDIEVSNKSPDEEVKLRRHHLARCMKNFKTDIYFVS
TFEPSTKSVDLLTVETFAGTVCKQTDSEMPKEWTINRGLYASFRYEGEWEHYPEWARNLY
LMELPARGLARVNGSDIERFYYNEDFVEKDSNDVVCEIFIPVRPV