Protein Info for KEDOAH_18415 in Escherichia coli ECRC99

Name: lfhA
Annotation: Putative truncated flagellar export/assembly protein LfhA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 86 to 107 (22 residues), see Phobius details amino acids 120 to 147 (28 residues), see Phobius details amino acids 168 to 199 (32 residues), see Phobius details PF00771: FHIPEP" amino acids 9 to 570 (562 residues), 631.4 bits, see alignment E=9.9e-194

Best Hits

Swiss-Prot: 99% identical to LFHA_ECOLI: Putative truncated flagellar export/assembly protein LfhA (lfhA) from Escherichia coli (strain K12)

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to ece:Z0290)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>KEDOAH_18415 Putative truncated flagellar export/assembly protein LfhA (Escherichia coli ECRC99)
MLSRSDLLTLLTINFIVVTKGAERISEVSARFTLDAMPGKQMAIDADLNAGLINQAQAQT
RRKDVASEADFYGAMDGASKFVRGDAIAGMMILAINLIGGVCIGIFKYNLSADAAFQQYV
LMTIGDGLVAQIPSLLLSTAAAIIVTRVSDNGDIAHDVRHQLLASPSVLYTATGIMFVLA
VVPGMPHLPFLLFSALLGFTGWRMSKQPQAAEAEEKSLETLTRTITETSEQQVSWETIPL
IEPISLSLGYKLVALVDKAQGNPLTQRIRGVRQVISDGNGVLLPEIRIRENFRLKPSQYA
IFINGIKADEADIPADKLMALPSSETYGEIDGVLGNDPAYGMPVTWIQPAQKAKALNMGY
QVIDSASVIATHVNKIVRSYIPDLFNYDDITQLHNRLSSMAPRLAEDLSAALNYSQLLKV
YRALLTEGVSLRDIVTIATVLVASSAVTKDHILLAADVRLALRRSITHPFVRKQELTVYT
LNNELENLLTNVVNQAQQGGKVMLDSVPVDPNMLNQFQSTMPQVKEQMKAAGKDPVLLVP
PQLRPLLARYARLFAPGLHVLSYNEVPDELELKIMGALS