Protein Info for KEDOAH_18040 in Escherichia coli ECRC99

Name: tilS
Annotation: tRNA lysidine(34) synthetase TilS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 PF01171: ATP_bind_3" amino acids 14 to 191 (178 residues), 215.3 bits, see alignment E=8.9e-68 TIGR02432: tRNA(Ile)-lysidine synthetase" amino acids 14 to 196 (183 residues), 176.2 bits, see alignment E=6.7e-56 PF09179: TilS" amino acids 241 to 308 (68 residues), 70.4 bits, see alignment E=1.9e-23 PF11734: TilS_C" amino acids 356 to 427 (72 residues), 85.8 bits, see alignment E=1.5e-28 TIGR02433: tRNA(Ile)-lysidine synthetase, C-terminal domain" amino acids 356 to 401 (46 residues), 57.4 bits, see alignment 7.2e-20

Best Hits

Swiss-Prot: 100% identical to TILS_ECO57: tRNA(Ile)-lysidine synthase (tilS) from Escherichia coli O157:H7

KEGG orthology group: K04075, tRNA(Ile)-lysidine synthase [EC: 6.3.4.-] (inferred from 100% identity to ecf:ECH74115_0198)

MetaCyc: 97% identical to tRNAIle-lysidine synthetase (Escherichia coli K-12 substr. MG1655)
RXN-1961 [EC: 6.3.4.19]

Predicted SEED Role

"tRNA(Ile)-lysidine synthetase (EC 6.3.4.19)" (EC 6.3.4.19)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.- or 6.3.4.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>KEDOAH_18040 tRNA lysidine(34) synthetase TilS (Escherichia coli ECRC99)
MTLTLNRQLLTSRQILVAFSGGLDSTVLLHQLVQWRTENPGGALRAIHVHHGLSANADAW
VTHCENVCQQWQVPLVVERVQLAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQ
CETFLLALKRGSGPAGLSAMAEVSEFAGTRLIRPLLARTRGELAQWALAHGLRWIEDESN
QDDSYDRNFLRLRVVPLLQQRWPHFAETTARSAALCAEQESLLDELLADDLAHCQSPQGT
LQIVPMLAMSDARRAAIIRRWLAGQNAPMPSRDALVRIWQEVALAREDASPCLRLGAFEI
RRYQSQLWWIKSVTGQSENIVPWQTWLQPLELPAGQGSVQLNAGGDIRPPRADEAVSVRF
KAPGLLHIVGRNGGRKLKKIWQELGVPPWLRDTTPLLFYGETLIAAAGGFVTQEGVAEGE
NGISFVWQRNA