Protein Info for KEDOAH_17905 in Escherichia coli ECRC99

Name: cdaR
Annotation: DNA-binding transcriptional regulator CdaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF05651: Diacid_rec" amino acids 6 to 139 (134 residues), 165.4 bits, see alignment E=8.7e-53 PF17853: GGDEF_2" amino acids 145 to 270 (126 residues), 62.2 bits, see alignment E=8.7e-21 PF13556: HTH_30" amino acids 323 to 380 (58 residues), 76.9 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 100% identical to CDAR_ECOLI: Carbohydrate diacid regulator (cdaR) from Escherichia coli (strain K12)

KEGG orthology group: K02647, carbohydrate diacid regulator (inferred from 100% identity to eco:b0162)

Predicted SEED Role

"Sugar diacid utilization regulator SdaR" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (385 amino acids)

>KEDOAH_17905 DNA-binding transcriptional regulator CdaR (Escherichia coli ECRC99)
MAGWHLDTKMAQDIVARTMRIIDTNINVMDARGRIIGSGDRERIGELHEGALLVLSQGRV
VDIDDAVARHLHGVRQGINLPLRLEGEIVGVIGLTGEPENLRKYGELVCMTAEMMLEQSR
LMHLLAQDSRLREELVMNLIQAEENTPALTEWAQRLGIDLNQPRVVAIVEVDSGQLGVDS
AMAELQQLQNALTTPERNNLVAIVSLTEMVVLKPALNSFGRWDVEDHRKRVEQLITRMKE
YGQLRFRVSLGNYFTGPGSIARSYRTAKTTMVVGKQRMPESRCYFYQDLMLPVLLDSLRG
DWQANELARPLARLKAMDNNGLLRRTLAAWFRHNVQPLATSKALFIHRNTLEYRLNRISE
LTGLDLGNFDDRLLLYVALQLDEER