Protein Info for KEDOAH_17875 in Escherichia coli ECRC99

Name: erpA
Annotation: iron-sulfur cluster insertion protein ErpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF01521: Fe-S_biosyn" amino acids 9 to 109 (101 residues), 74.7 bits, see alignment E=3.5e-25 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 10 to 113 (104 residues), 130.6 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 100% identical to ERPA_SHIDS: Iron-sulfur cluster insertion protein ErpA (erpA) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: None (inferred from 100% identity to eco:b0156)

Predicted SEED Role

"ErpA, essential respiratory protein A / probable iron binding protein from the HesB_IscA_SufA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (114 amino acids)

>KEDOAH_17875 iron-sulfur cluster insertion protein ErpA (Escherichia coli ECRC99)
MSDDVALPLEFTDAAANKVKSLIADEDNPNLKLRVYITGGGCSGFQYGFTFDDQVNEGDM
TIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSFSI