Protein Info for KEDOAH_17415 in Escherichia coli ECRC99

Name: sgrR
Annotation: DNA-binding transcriptional regulator SgrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 PF12793: SgrR_N" amino acids 5 to 118 (114 residues), 143.9 bits, see alignment E=2.5e-46 PF00496: SBP_bac_5" amino acids 165 to 306 (142 residues), 69.7 bits, see alignment E=2.5e-23

Best Hits

Swiss-Prot: 100% identical to SGRR_ECO57: HTH-type transcriptional regulator SgrR (sgrR) from Escherichia coli O157:H7

KEGG orthology group: K11925, SgrR family transcriptional regulator (inferred from 100% identity to ecs:ECs0074)

Predicted SEED Role

"SgrR, sugar-phosphate stress, transcriptional activator of SgrS small RNA" in subsystem Sugar-phosphate stress regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>KEDOAH_17415 DNA-binding transcriptional regulator SgrR (Escherichia coli ECRC99)
MPSARLQQQFIRLWQCCEGKSQDTTLNELAALLSCSRRHMRTLLNTMQDRGWLTWEAEVG
RGKRSRLTFLYTGLALQQQRAEDLLEQDRIDQLVQLVGDKATVRQMLVSHLGRSFRQGRH
ILRVLYYRPLRNLLPGSALRRSETHIARQIFSSLTRINEENGELEADIAHHWQQISPLHW
RFFLRPGVHFHHGRELEMDDVIASLKRINTLPLYSHIADIVSPTPWTLDIHLTQPDRWLP
LLLGQVPAMILPREWETLSNFASHPIGTGPYAVIRNSTNQLKIQAFDDFFGYRALIDEVN
VWVLPEIADEPAGGLMLKGPQGEEKEIESRLEEGCYYLLFDSRTHRGANQQVRDWVSYVL
SPTNLVYFAEEQYQQLWFPAYGLLPRWHHARTITSEKPAGLESLTLTFYQDHSEHRVIAG
IMQQILASHQVTLEIKEISYDQWHEGEIESDIWLNSANFTLPLDFSLFAHLCEVPLLQHC
IPIDWQVDAARWRNGEMNLANWCQQLVASKAMVPLIHHWLIIQGQRSMRGLRMNTLGWFD
FKSAWFAPPDPE