Protein Info for KEDOAH_16995 in Escherichia coli ECRC99

Name: yjjX
Annotation: inosine/xanthosine triphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00258: inosine/xanthosine triphosphatase
  • amino acids 6 to 170 (165 residues), 239.1 bits, E=1.4e-75
• PF01931: NTPase_I-T
  • amino acids 7 to 165 (159 residues), 174.1 bits, E=1e-55

Best Hits

Swiss-Prot: 100% identical to NCPP_ECO57: Inosine/xanthosine triphosphatase (yjjX) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to eco:b4394)

MetaCyc: 98% identical to inosine/xanthosine triphosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-5073 [EC: 3.6.1.73]; 3.6.1.73 [EC: 3.6.1.73]

Predicted SEED Role

"Inosine/xanthosine triphosphatase (EC 3.6.1.-)" (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Lipopolysaccharide biosynthesis
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.73

Protein Sequence (170 amino acids)

>KEDOAH_16995 inosine/xanthosine triphosphatase (Escherichia coli ECRC99)
MHQVVCATTNPAKIQAILQAFHEIFGEGSCHIASIAVESGVPEQPFGSEETRAGARNRVA
NARRLLPEADFWVAIEAGIDGDSTFSWVVIENTTQRGEARSATLPLPAVILEKVREGEAL
GPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVILALSPFHNAVY