Protein Info for KEDOAH_16850 in Escherichia coli ECRC99

Name: holD
Annotation: DNA polymerase III subunit psi

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00664: DNA polymerase III, psi subunit" amino acids 1 to 125 (125 residues), 207 bits, see alignment E=4.8e-66 PF03603: DNA_III_psi" amino acids 3 to 127 (125 residues), 156.4 bits, see alignment E=2.1e-50

Best Hits

Swiss-Prot: 98% identical to HOLD_ECOLI: DNA polymerase III subunit psi (holD) from Escherichia coli (strain K12)

KEGG orthology group: K02344, DNA polymerase III subunit psi [EC: 2.7.7.7] (inferred from 99% identity to sfx:S4675)

MetaCyc: 98% identical to DNA polymerase III subunit psi (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA polymerase III psi subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (137 amino acids)

>KEDOAH_16850 DNA polymerase III subunit psi (Escherichia coli ECRC99)
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSRCNSWRLGTDEPLSLEGAQVASPALTELRANPTARAA
LWQQICTYEHDFFPRND