Protein Info for KEDOAH_15630 in Escherichia coli ECRC99

Name: melB
Annotation: melibiose:sodium transporter MelB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 53 (21 residues), see Phobius details amino acids 74 to 96 (23 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 320 to 345 (26 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 4 to 446 (443 residues), 575.7 bits, see alignment E=2.8e-177 PF13347: MFS_2" amino acids 6 to 432 (427 residues), 270.4 bits, see alignment E=1.1e-84

Best Hits

Swiss-Prot: 99% identical to MELB_ECOLI: Melibiose carrier protein (melB) from Escherichia coli (strain K12)

KEGG orthology group: K11104, melibiose permease (inferred from 99% identity to eco:b4120)

MetaCyc: 99% identical to melibiose:H+/Na+/Li+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-17755; TRANS-RXN-94; TRANS-RXN-94A; TRANS-RXN-94B; TRANS-RXN0-519; TRANS-RXN0-520

Predicted SEED Role

"Melibiose carrier protein, Na+/melibiose symporter" in subsystem Melibiose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>KEDOAH_15630 melibiose:sodium transporter MelB (Escherichia coli ECRC99)
MTTKLSYGFGAFGKDFAIGIVYMYLMYYYTDVVGLSVGLVGTLFLVARIWDAINDPIMGW
IVNATRSRWGKFKPWILIGTLANSVILFLLFSAHLFEGTTQIAFVCVTYILWGMTYTIMD
IPFWSLVPTITLDKREREQLVPYPRFFASLAGFVTAGVTLPFVNYVGGGDRGFGFQMFTL
VLIAFFIVSTIITLRNVHEVFSSDNQPSAEGSHLTLKAIVALIYKNDQLSCLLGMALAYN
VASNIITGFAIYYFSYVIGDADLFPYYLSYAGAANLVTLVFFPRLVKSLSRRILWAGASI
LPVLSCGVLLLMALMSYHNVVLIVIAGILLNVGTALFWVLQVIMVADTVDYGEYKLHVRC
ESIAYSVQTMVVKGGSAFAAFFIAVVLGMIGYVPNVEQSTQALLGMQFIMIALPTLFFMV
TLILYFRFYRLNGDTLRRIQIHLLDKYRKIPPEPVHADIPVGAVSDVKA