Protein Info for KEDOAH_15540 in Escherichia coli ECRC99

Name: phnC
Annotation: phosphonate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 20 to 170 (151 residues), 111.8 bits, E=2.1e-36
  • amino acids 168 to 192 (25 residues), 25.2 bits, see alignment (E = 1.1e-09)

Best Hits

Swiss-Prot: 93% identical to PHNC_ECO57: Phosphonates import ATP-binding protein PhnC (phnC) from Escherichia coli O157:H7

KEGG orthology group: K02041, phosphonate transport system ATP-binding protein (inferred from 93% identity to ecs:ECs5088)

Predicted SEED Role

"Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Protein Sequence (273 amino acids)

>KEDOAH_15540 phosphonate ABC transporter ATP-binding protein (Escherichia coli ECRC99)
MQTIICVEQLSKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSA
GSHIELLGRTVQREGRLARDIRKSRANTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTREQKQRALQALTRVGMAHFAYQRVSTLSGGQQQRVAIARALMQQRVAIARALMQ
QAKVILADEPIASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQG
HVFYDGSSQQFDNERFDHLYRSINRVEENAKAA