Protein Info for KEDOAH_15310 in Escherichia coli ECRC99

Name: yjcH
Annotation: DUF485 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04341: DUF485
  • amino acids 11 to 98 (88 residues), 109.5 bits, E=3.4e-36

Best Hits

Swiss-Prot: 99% identical to YJCH_SHIFL: Inner membrane protein YjcH (yjcH) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to eco:b4068)

Predicted SEED Role

"Putative membrane protein, clustering with ActP" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Protein Sequence (104 amino acids)

>KEDOAH_15310 DUF485 domain-containing protein (Escherichia coli ECRC99)
MNGTIYQRIEDNAHFRELVEKRQRFATILSIIMLAVYIGFILLIAFAPGWLGTPLNPNTS
VTRGIPVGVGVIVISFVLTGIYIWRANGEFDRLNNEVLHEVQAS