Protein Info for KEDOAH_14580 in Escherichia coli ECRC99

Annotation: acetylglutamate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00696: AA_kinase" amino acids 5 to 235 (231 residues), 148 bits, see alignment E=2e-47 TIGR00761: acetylglutamate kinase" amino acids 5 to 234 (230 residues), 261.3 bits, see alignment E=3.7e-82

Best Hits

Swiss-Prot: 100% identical to ARGB_ECOK1: Acetylglutamate kinase (argB) from Escherichia coli O1:K1 / APEC

KEGG orthology group: K00930, acetylglutamate/acetylaminoadipate kinase [EC: 2.7.2.- 2.7.2.8] (inferred from 100% identity to eco:b3959)

MetaCyc: 100% identical to acetylglutamate kinase (Escherichia coli K-12 substr. MG1655)
Acetylglutamate kinase. [EC: 2.7.2.8]

Predicted SEED Role

"Acetylglutamate kinase (EC 2.7.2.8)" in subsystem Arginine Biosynthesis extended (EC 2.7.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.- or 2.7.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>KEDOAH_14580 acetylglutamate kinase (Escherichia coli ECRC99)
MMNPLIIKLGGVLLDSEEALERLFSALVNYRESHQRPLVIVHGGGCVVDELMKGLNLPVK
KKNGLRVTPADQIDIITGALAGTANKTLLAWAKKHQIAAVGLFLGDGDSVKVTQLDEELG
HVGLAQPGSPKLINSLLENGYLPVVSSIGVTDEGQLMNVNADQAATALAATLGADLILLS
DVSGILDGKGQRIAEMTAAKAEQLIEQGIITDGMIVKVNAALDAARTLGRPVDIASWRHA
EQLPALFNGMPMGTRILA