Protein Info for KEDOAH_14025 in Escherichia coli ECRC99

Name: yihI
Annotation: Der GTPase-activating protein YihI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF04220: YihI" amino acids 13 to 165 (153 residues), 185.9 bits, see alignment E=2.1e-59

Best Hits

Swiss-Prot: 100% identical to YIHI_ECO57: Der GTPase-activating protein YihI (yihI) from Escherichia coli O157:H7

KEGG orthology group: K09894, hypothetical protein (inferred from 99% identity to sdy:SDY_3877)

MetaCyc: 98% identical to Der GTPase-activating protein YihI (Escherichia coli K-12 substr. MG1655)
RXN-21992

Predicted SEED Role

"Protein of unknown function DUF414" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>KEDOAH_14025 Der GTPase-activating protein YihI (Escherichia coli ECRC99)
MKPSSPSRSKGHAKARRKTREELNQEARDRKRQKKRRGHAPGSRAAGGNNTSGSKGQNAP
KDPRIGSKTPIPLGVTEKVTKQHKPKSEKPMLSPQAELELLETDERLDALLERLEAGETL
SAEEQSWVDAKLDRIDELMQKLGLSYDDDEEEEEDEKQEDMMRLLRGN