Protein Info for KEDOAH_13960 in Escherichia coli ECRC99

Name: mobB
Annotation: molybdopterin-guanine dinucleotide biosynthesis protein MobB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03205: MobB
  • amino acids 10 to 144 (135 residues), 166.7 bits, E=1.3e-53
• TIGR00176: molybdopterin-guanine dinucleotide biosynthesis protein B
  • amino acids 10 to 169 (160 residues), 167.9 bits, E=8.2e-54

Best Hits

Swiss-Prot: 99% identical to MOBB_ECOLI: Molybdopterin-guanine dinucleotide biosynthesis adapter protein (mobB) from Escherichia coli (strain K12)

KEGG orthology group: K03753, molybdopterin-guanine dinucleotide biosynthesis protein B (inferred from 100% identity to ecf:ECH74115_5296)

Predicted SEED Role

"Molybdopterin-guanine dinucleotide biosynthesis protein MobB" in subsystem Molybdenum cofactor biosynthesis

Protein Sequence (175 amino acids)

>KEDOAH_13960 molybdopterin-guanine dinucleotide biosynthesis protein MobB (Escherichia coli ECRC99)
MAGKTMIPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHDMDVDKPGKDSYEL
RKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVL
FRDGAGHRPEELVIDRHVIAVASDVPLNLDVALLDINDVEGLADFVVEWMQNQDG