Protein Info for KEDOAH_13350 in Escherichia coli ECRC99

Name: atpB
Annotation: F0F1 ATP synthase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details TIGR01131: ATP synthase F0, A subunit" amino acids 38 to 266 (229 residues), 145.8 bits, see alignment E=9.6e-47 PF00119: ATP-synt_A" amino acids 46 to 265 (220 residues), 191.9 bits, see alignment E=7.3e-61

Best Hits

Swiss-Prot: 100% identical to ATP6_ECO5E: ATP synthase subunit a (atpB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to eco:b3738)

MetaCyc: 100% identical to ATP synthase Fo complex subunit a (Escherichia coli K-12 substr. MG1655)
ATPSYN-RXN [EC: 7.1.2.2]; RXN0-7041 [EC: 7.1.2.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14 or 7.1.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>KEDOAH_13350 F0F1 ATP synthase subunit A (Escherichia coli ECRC99)
MASENMTPQDYIGHHLNNLQLDLRTFSLVDPQNPPATFWTINIDSMFFSVVLGLLFLVLF
RSVAKKATSGVPGKFQTAIELVIGFVNGSVKDMYHGKSKLIAPLALTIFVWVFLMNLMDL
LPIDLLPYIAEHVLGLPALRVVPSADVNVTLSMALGVFILILFYSIKMKGIGGFTKELTL
QPFNHWAFIPVNLILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVP
WAIFHILIITLQAFIFMVLTIVYLSMASEEH