Protein Info for KEDOAH_13160 in Escherichia coli ECRC99

Name: yidC
Annotation: membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 548 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 350 to 372 (23 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 463 to 481 (19 residues), see Phobius details amino acids 494 to 519 (26 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 3 to 352 (350 residues), 391.7 bits, see alignment E=4.6e-121 PF14849: YidC_periplas" amino acids 61 to 343 (283 residues), 314.2 bits, see alignment E=1.3e-97 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 353 to 533 (181 residues), 230.2 bits, see alignment E=2.1e-72 PF02096: 60KD_IMP" amino acids 354 to 533 (180 residues), 211.9 bits, see alignment E=5.5e-67

Best Hits

Swiss-Prot: 100% identical to YIDC_ECO57: Membrane protein insertase YidC (yidC) from Escherichia coli O157:H7

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to eco:b3705)

MetaCyc: 100% identical to membrane protein insertase YidC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-403

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (548 amino acids)

>KEDOAH_13160 membrane protein insertase YidC (Escherichia coli ECRC99)
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL
ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP
DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV
QNAGEKPLEISTFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD
NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT
GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII
ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL
GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK
MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL
HSREKKKS