Protein Info for KEDOAH_13090 in Escherichia coli ECRC99

Name: yidR
Annotation: Uncharacterized protein YidR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF12566: DUF3748" amino acids 63 to 179 (117 residues), 193.2 bits, see alignment E=1.3e-61

Best Hits

Swiss-Prot: 96% identical to YIDR_ECOLI: Uncharacterized protein YidR (yidR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecs:ECs4629)

Predicted SEED Role

"Uncharacterized protein YidR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>KEDOAH_13090 Uncharacterized protein YidR (Escherichia coli ECRC99)
MKQITFAPRNHLLTNTNTWTPDSQWLVFDVRPSGASFTGETIERVNIHTGEVEVIYRVSQ
GAHVGVVTVHPKSEKYVFIHGPENPHETWHYDFHHRRGVIVEGGKMNNLDAMDITVPYTS
GALRGGSHVHVFSPNGEMVSFTYNDHVMHQFDSALDLRNVGVAAPFGPVNVQKQHPREYS
GSHWCVLVSKTTPTPQPGSDEINRAYEEGWVGNHALAFIGDTLSPKGEKVPELFIVELPQ
DEAGWKAAGDAPLSGTETTLPAPPRGIVQRRLTFTHHRAYPGLVNVPRHWVRCNPQGTQI
AFLMRDDNGIVQLWLISPQGGEPRQLTHNKTDIQSAFNWHPSGEWLGFVLGNRIACAHAQ
SGEVEYLTENHANPPSADAVVFSPDGQWLAWMEGGQLWITETDR