Protein Info for KEDOAH_12955 in Escherichia coli ECRC99

Name: uhpC
Annotation: MFS transporter family glucose-6-phosphate receptor UhpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 286 to 309 (24 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 377 to 400 (24 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details PF07690: MFS_1" amino acids 35 to 396 (362 residues), 183.8 bits, see alignment E=4.6e-58 TIGR00881: phosphoglycerate transporter family protein" amino acids 36 to 413 (378 residues), 509.4 bits, see alignment E=3.1e-157

Best Hits

Swiss-Prot: 100% identical to UHPC_ECOLI: Membrane sensor protein UhpC (uhpC) from Escherichia coli (strain K12)

KEGG orthology group: K07783, MFS transporter, OPA family, sugar phosphate sensor protein UhpC (inferred from 100% identity to eco:b3667)

Predicted SEED Role

"Hexose phosphate uptake regulatory protein UhpC" in subsystem Hexose Phosphate Uptake System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (439 amino acids)

>KEDOAH_12955 MFS transporter family glucose-6-phosphate receptor UhpC (Escherichia coli ECRC99)
MLPFLKAPADAPLMTDKHEIDARYRYWRRHILLTIWLGYALFYFTRKSFNAAVPEILANG
VLSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWA
FAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGALIPIVMAAAALH
YGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRHDALEIAQQQEGAGLTRKE
ILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAVTMFELGGF
IGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMPFASYVMQATCFFTIGFFVFG
PQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWPLAKVLDTWHWSGFFVVIAIAA
GISALLLLPFLNAQTPREA