Protein Info for KEDOAH_12940 in Escherichia coli ECRC99

Annotation: Permease family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 32 to 301 (270 residues), 89.8 bits, see alignment E=8e-30

Best Hits

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to ece:Z5154)

Predicted SEED Role

"Xanthine/uracil/thiamine/ascorbate permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>KEDOAH_12940 Permease family (Escherichia coli ECRC99)
MNNDNTDYVSNESGTLSRLFKLPQHGTTVRTELIAGMTTFLTMVYIVFVNPQILGAAQMD
PKVVFVTTCLIAGIGSIAMGIFANLPVALAPAMGLNAFFAFVVVGAMGISWQTGMGAIFW
GAIGLFLLTLFRIRYWMISNIPLSLRIGITSGIGLFIALMGLKNTGVIVANKDTLVMIGD
LSSHGVLLGILGFFIITVLSSRHFHAAVLVSIVVTSCCGLFFGDVHFSGVYSIPPDISGV
IGEVDLSGALTLELAGIIFSFMLINLFDSSGTLIGVTDKAGLIDSNGKFPNMNKALYVDS
VVRWRARLSAPRLLPPILKVLLVWQSVVARG