Protein Info for KEDOAH_12480 in Escherichia coli ECRC99

Name: rfaY
Annotation: lipopolysaccharide core heptose(II) kinase RfaY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06176: WaaY
  • amino acids 1 to 229 (229 residues), 311.8 bits, E=3.1e-97

Best Hits

Swiss-Prot: 56% identical to RFAY_ECOLI: Lipopolysaccharide core heptose(II) kinase RfaY (rfaY) from Escherichia coli (strain K12)

KEGG orthology group: K02850, heptose (II) phosphotransferase [EC: 2.7.1.-] (inferred from 100% identity to eok:G2583_4364)

MetaCyc: 56% identical to lipopolysaccharide core heptose (II) kinase (Escherichia coli K-12 substr. MG1655)
2.7.1.-

Predicted SEED Role

"Lipopolysaccharide core biosynthesis protein RfaY" in subsystem LOS core oligosaccharide biosynthesis

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (22/25 steps found)
• lipid A-core biosynthesis (Salmonella) (9/10 steps found)
• lipid A-core biosynthesis (E. coli K-12) (7/10 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-

Use Curated BLAST to search for 2.7.1.-

Protein Sequence (235 amino acids)

>KEDOAH_12480 lipopolysaccharide core heptose(II) kinase RfaY (Escherichia coli ECRC99)
MIYNKTINGVKVFIKDNDPFYEQVLNDFLTCRVKTLKVFRSIDDTKVILIDTARGPLVLK
VYAPKHKMTERFLKSCIKKDYYENLIYQTDRVRGEGIQSINDYFLLAERKTLNFAHYYIM
LIEYIEGVGLNEYLEISEDLKDQLSESIKELHQHGMVSGDPHKGNFIVSEKGLRLIDLSG
KKTTAVLKAKDRIDLERHYNIKNELKDFGYTYLIFKKKIKKVIRDVKVKLGLKSK