Protein Info for KEDOAH_12430 in Escherichia coli ECRC99
Name: waaH
Annotation: UDP-glucuronate:LPS(HepIII) glycosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to YIBD_ECOLI: Uncharacterized glycosyltransferase YibD (yibD) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to ece:Z5042)MetaCyc: 99% identical to UDP-glucuronate:LPS(HepIII) glycosyltransferase (Escherichia coli K-12 substr. MG1655)
Glucuronosyltransferase. [EC: 2.4.1.17]
Predicted SEED Role
"Beta-1,3-galactosyltransferase / Beta-1,4-galactosyltransferase" in subsystem LOS core oligosaccharide biosynthesis
MetaCyc Pathways
- serotonin degradation (2/7 steps found)
KEGG Metabolic Maps
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- C21-Steroid hormone metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
- Starch and sucrose metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.4.1.17
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (338 amino acids)
>KEDOAH_12430 UDP-glucuronate:LPS(HepIII) glycosyltransferase (Escherichia coli ECRC99) MMNSTNKLSVIIPLYNAGDDFRTCMESLITQTWTALEIIIINDGSTDNSVEIAKHYAENY PHVRLLHQANAGASVARNRGIEVATGKYVAFVDADDEVYPTMYETLMTMALEDDLDVAQC NADWSFRETGETWQSIPSDRLRSTGVLTGPDWLRMGLSSRRWTHVVWMGVYRRDVIVKNN IKFIAGLHHQDIVWTTEFMFNALRARYTEQSLYKYYLHNTSVSRLHRQGNKNLNYQRHYI KITRLLEKLNRNYADKIMIYPEFHQQITYEALRVCHAVRKEPDILTRQRMIAEIFTSGMY KRLITNVRSVKVGYQALLWSFRLWQWREKNAVAPSHYA