Protein Info for KEDOAH_11930 in Escherichia coli ECRC99

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 108 to 129 (22 residues), see Phobius details amino acids 149 to 171 (23 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 5 to 91 (87 residues), 39.4 bits, see alignment E=3.7e-14 amino acids 96 to 299 (204 residues), 35.9 bits, see alignment E=4.2e-13 PF07690: MFS_1" amino acids 141 to 295 (155 residues), 53.2 bits, see alignment E=2.3e-18

Best Hits

Predicted SEED Role

"Inner membrane metabolite transport protein YhjE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>KEDOAH_11930 MFS transporter (Escherichia coli ECRC99)
VVNGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGTFLLLSWLLTDEQFMSWGWRVP
FIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLGTLLTKHVRVTVLGTFIMLATY
TLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIGFGVMVPVAGLLADAFGRRKSM
VIITTLIILFALFAFNPLLGSGNPILVFAFLLLGLSLMGLTFGPMGALLPELFPTEVRYT
GASFSYNVASILGASVAPYIAAWLQTNYGLSAVGLYLAAMAGLTLIALLLTHETRHQSL