Protein Info for KEDOAH_11605 in Escherichia coli ECRC99

Name: nikD
Annotation: nickel import ATP-binding protein NikD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 TIGR02770: nickel import ATP-binding protein NikD" amino acids 18 to 245 (228 residues), 352.9 bits, see alignment E=3.3e-110 PF00005: ABC_tran" amino acids 20 to 169 (150 residues), 98.2 bits, see alignment E=3.2e-32

Best Hits

Swiss-Prot: 100% identical to NIKD_ECO57: Nickel import ATP-binding protein NikD (nikD) from Escherichia coli O157:H7

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 99% identity to eco:b3479)

MetaCyc: 99% identical to nickel ABC transporter ATP binding subunit NikD (Escherichia coli K-12 substr. MG1655)
7.2.2.i [EC: 7.2.2.i]; 7.2.2.- [EC: 7.2.2.i]

Predicted SEED Role

"Nickel transport ATP-binding protein NikD (TC 3.A.1.5.3)" in subsystem Transport of Nickel and Cobalt (TC 3.A.1.5.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.i

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>KEDOAH_11605 nickel import ATP-binding protein NikD (Escherichia coli ECRC99)
MPQQIELRNIALQAAQPLVHGVSLTLKRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFNAPKHAVTRSL
VSAHLALYGMELAS