Protein Info for KEDOAH_11555 in Escherichia coli ECRC99

Annotation: Conserved integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 772 transmembrane" amino acids 14 to 32 (19 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 310 to 332 (23 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details amino acids 429 to 448 (20 residues), see Phobius details amino acids 630 to 652 (23 residues), see Phobius details amino acids 659 to 680 (22 residues), see Phobius details amino acids 686 to 705 (20 residues), see Phobius details amino acids 717 to 736 (20 residues), see Phobius details amino acids 742 to 763 (22 residues), see Phobius details signal peptide" amino acids 33 to 34 (2 residues), see Phobius details PF03176: MMPL" amino acids 252 to 395 (144 residues), 33.2 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to eok:G2583_4190)

Predicted SEED Role

"FIG021862: membrane protein, exporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (772 amino acids)

>KEDOAH_11555 Conserved integral membrane protein (Escherichia coli ECRC99)
MTNANVLPPSKRPALLWGLVCLVMAVALLILLPQSRLNSSVLAMLPKQTMGDIPPALNDG
FMQRLDRQLVWLVSPGKEANPLVAQEWLTLLQKSAALGDVKGPMDAASQQAWGAFFWQHR
NGLIDPNTRARLQNGGEAQAQWILSQLYSAFSGVSGKELQNDPLMLMRGSQLAMAKNGQR
LRLMDGWLVTQDPQGNYWYLLHGELAGSSFDMQQTHQLITTLNTLEKDLKTRYPQAQLLS
RGTVFYSDYASQQAKQDISTLGVATLLGVILLIVAVFRSLRPLLLCVISIGIGALAGTVA
TLLIFGELHLMTLVMSMSVIGISADYTLYYLTERMVHGNDVSPWQSLAKVRNALLLALLT
TVAAYLIMMLAPFPGIRQMAIFAAVGLSASCLTVLFWHPWLCRGLPVRPVPAMALMLRWL
AAWRRNKKLSLGLPVALALFSLAGMSMLRVDDDISQLQALPQHILAQEKAITALTGQSVD
QKWFVVYGDSPQQTLRRLEKYTASLEYAKKEGLISNYRTIPLNSLARQEEDLQLLKTAAP
TVTKALQNAGLTAVNPDLNAMPVNVDEWLASPASEGWRLLWLTLENGESGVLVPVEGVKS
SALMQEIATYYPCGIAWVDRKSTFDELFALYRYVLTGLLLVALAVIACGAVARLGWRKGL
ISLVPSVLSLGCGLAVLAMSGQAVNLFSLLALVLVLGIGINYTLFFSNPRGTPLTSLLAI
ALAMLTTLLTLGMLVFSATQAISSFGIVLVSGIFTAFLLSPLAMPDKKRTKK