Protein Info for KEDOAH_11340 in Escherichia coli ECRC99

Name: ggt
Annotation: gamma-glutamyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 581 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR00066: gamma-glutamyltransferase" amino acids 50 to 572 (523 residues), 783.2 bits, see alignment E=5.3e-240 PF01019: G_glu_transpept" amino acids 65 to 573 (509 residues), 646.1 bits, see alignment E=2.4e-198

Best Hits

Swiss-Prot: 98% identical to GGT_ECOLI: Glutathione hydrolase proenzyme (ggt) from Escherichia coli (strain K12)

KEGG orthology group: K00681, gamma-glutamyltranspeptidase [EC: 2.3.2.2] (inferred from 100% identity to ecs:ECs4293)

MetaCyc: 98% identical to glutathione hydrolase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Gamma-glutamyltranspeptidase (EC 2.3.2.2)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Utilization of glutathione as a sulphur source (EC 2.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (581 amino acids)

>KEDOAH_11340 gamma-glutamyltransferase (Escherichia coli ECRC99)
MIKPTFLRRVAIAALFTGSCFSTVAAPPAPSPVSYGVEEDVFHPVRAKQGMVASVDATAT
QVGVDILKEGGNAVDAAVAVGYALAVTHPQAGNLGGGGFMLIRSKNGNTTAIDFREMAPA
KATRDMFLDDQGNPDSKKSLTSHLASGTPGTVAGFSLALDKYGTMPLNKVVQPAFKLARD
GFIVNDELADDLKTYGSEVLPNHENSKAIFWKEGEPLKKGDKLVQANLAKSLEMIAENGP
DEFYKGTIAEQIAQEMQKNGGLITKEDLAAYKAVERTPISGDYRGYQVYSMPPPSSGGIH
IVQILNILENFDMKKYGFGSADAMQIMAEAEKYAYADRSEYLGDPDFVKVPWQALTNKAY
AKSIAEQIDINKAKPSSEIRPGKLAPYESNQTTHYSVVDKDGNAVAVTYTLNTTFGTGIV
AGESGILLNNQMDDFSAKPGVPNVYGLVGGDANAVGPNKRPLSSMSPTIVVKDGKTWLVT
GSPGGSLIITTVLQMVVNSIDYGMNVAEATNAPRFHHQWLPDELRVEKGFSPDTLKLLEA
KGQKVALKEAMGSTQSIMVGPDGELYGASDPRSVDDLTAGY