Protein Info for KEDOAH_11030 in Escherichia coli ECRC99

Name: aroK
Annotation: shikimate kinase AroK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF13238: AAA_18" amino acids 59 to 192 (134 residues), 33.9 bits, see alignment E=6.4e-12 PF13671: AAA_33" amino acids 59 to 188 (130 residues), 28.7 bits, see alignment E=2.2e-10 PF01202: SKI" amino acids 65 to 222 (158 residues), 201.3 bits, see alignment E=1.5e-63

Best Hits

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 100% identity to ecm:EcSMS35_3666)

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.71

Use Curated BLAST to search for 2.7.1.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>KEDOAH_11030 shikimate kinase AroK (Escherichia coli ECRC99)
MGDLFSCQTRWSIEIIFSLTLAISYEVSVHVLRSSLSEAGLSLTNSLSSTEKMAEKRNIF
LVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVIN
ELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLHVETP
PREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN