Protein Info for KEDOAH_10955 in Escherichia coli ECRC99

Name: nirC
Annotation: nitrite transporter NirC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 25 to 48 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 150 to 171 (22 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 9 to 247 (239 residues), 199.3 bits, see alignment E=3.2e-63 TIGR00790: formate/nitrite transporter" amino acids 21 to 250 (230 residues), 280.9 bits, see alignment E=4.3e-88

Best Hits

Swiss-Prot: 100% identical to NIRC_ECOLI: Nitrite transporter NirC (nirC) from Escherichia coli (strain K12)

KEGG orthology group: K02598, nitrite transporter NirC (inferred from 100% identity to eco:b3367)

MetaCyc: 100% identical to nitrite transporter NirC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-137

Predicted SEED Role

"Nitrite transporter NirC" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>KEDOAH_10955 nitrite transporter NirC (Escherichia coli ECRC99)
MFTDTINKCAANAARIARLSANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLV
MGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGTISHGQMWAILPQTWLGNLVGSVFVA
MLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKF
IAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVF
MGLGYWYATPKANRPVADKFNQTETAAG