Protein Info for KEDOAH_10695 in Escherichia coli ECRC99

Name: rpsE
Annotation: 30S ribosomal protein S5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01021: ribosomal protein uS5
  • amino acids 10 to 163 (154 residues), 237.4 bits, E=3.1e-75
• PF00333: Ribosomal_S5
  • amino acids 11 to 74 (64 residues), 103.7 bits, E=4.3e-34
• PF03719: Ribosomal_S5_C
  • amino acids 89 to 157 (69 residues), 105.2 bits, E=9.8e-35

Best Hits

Swiss-Prot: 100% identical to RS5_ECO57: 30S ribosomal protein S5 (rpsE) from Escherichia coli O157:H7

KEGG orthology group: K02988, small subunit ribosomal protein S5 (inferred from 100% identity to eco:b3303)

MetaCyc: 100% identical to 30S ribosomal subunit protein S5 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S5p (S2e)" in subsystem Ribosomal protein S5p acylation or Ribosome SSU bacterial

Protein Sequence (167 amino acids)

>KEDOAH_10695 30S ribosomal protein S5 (Escherichia coli ECRC99)
MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAI
QKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGGAMRAVLEVAGV
HNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGKSVEEILGK