Protein Info for KEDOAH_10495 in Escherichia coli ECRC99

Name: acrF
Annotation: multidrug efflux RND transporter permease subunit AcrF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 628 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 340 to 359 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 395 to 416 (22 residues), see Phobius details amino acids 438 to 460 (23 residues), see Phobius details amino acids 470 to 495 (26 residues), see Phobius details amino acids 540 to 558 (19 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 627 (627 residues), 1125.5 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 622 (622 residues), 875.9 bits, see alignment E=3.6e-267 PF03176: MMPL" amino acids 333 to 499 (167 residues), 23.8 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ece:Z4626)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (628 amino acids)

>KEDOAH_10495 multidrug efflux RND transporter permease subunit AcrF (Escherichia coli ECRC99)
MANFFIRRPIFAWVLAIILMMAGALAILQLPVAQYPTIAPPAVSVSANYPGADAQTVQDT
VTQVIEQNMNGIDNLMYMSSTSDSAGSVTITLTFQSGTDPDIAQVQVQNKLQLATPLLPQ
EVQQQGISVEKSSSSYLMVAGFVSDNPDTTQDDISDYVASNVKDTLSRLNSVGDVQLFGA
QYAMRIWLDADLLNKYKLTPVDVINQLKVQNAQIAAGQLGGTPALPGQQLNASIIAQTRL
KNPEEFGKVTLRVNSDGSVVRLKDVARVELGGENYNVIARINGKPAAGLGIKLATGANAL
DTAKAIKAKLAELQPFFPQGMKVLYPYDTTPFVQLSIHEVVKTLFEAIMLVFLVMYLFLQ
NMRATLIPTIAVPVVLLGTFAILAAFGYSINTLTMFGMVLAIGLLVDDAIVVVENVERVM
MEDKLPPKEATEKSMSQIQGALVGIAMVLSAVFIPMAFFGGSTGAIYRQFSITIVSAMAL
SVLVALILTPALCATLLKPTSAEHHENKGGFFGWFNTTFDHSVNHYTNSVGKILGSTGRY
LLIYALIVAGMVVLFLRLPSSFLPEEDQGVFLTMIQLPAGATQERTQKVLDQVTDYYLKN
EKANVESVFTVNGFSFSGQAPPQPHVFT