Protein Info for KEDOAH_09740 in Escherichia coli ECRC99

Name: tdcC
Annotation: threonine/serine transporter TdcC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 48 to 66 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 206 to 233 (28 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details TIGR00814: serine transporter" amino acids 17 to 433 (417 residues), 574 bits, see alignment E=8.7e-177 PF03222: Trp_Tyr_perm" amino acids 29 to 438 (410 residues), 33.7 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 100% identical to TDCC_ECOLI: Threonine/serine transporter TdcC (tdcC) from Escherichia coli (strain K12)

KEGG orthology group: K03838, threonine transporter (inferred from 100% identity to eco:b3116)

MetaCyc: 100% identical to threonine/serine:H+ symporter TdcC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-71; TRANS-RXN-72

Predicted SEED Role

"L-threonine transporter, anaerobically inducible" in subsystem Threonine anaerobic catabolism gene cluster or Threonine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>KEDOAH_09740 threonine/serine transporter TdcC (Escherichia coli ECRC99)
MSTSDSIVSSQTKQSSWRKSDTTWTLGLFGTAIGAGVLFFPIRAGFGGLIPILLMLVLAY
PIAFYCHRALARLCLSGSNPSGNITETVEEHFGKTGGVVITFLYFFAICPLLWIYGVTIT
NTFMTFWENQLGFAPLNRGFVALFLLLLMAFVIWFGKDLMVKVMSYLVWPFIASLVLISL
SLIPYWNSAVIDQVDLGSLSLTGHDGILITVWLGISIMVFSFNFSPIVSSFVVSKREEYE
KDFGRDFTERKCSQIISRASMLMVAVVMFFAFSCLFTLSPANMAEAKAQNIPVLSYLANH
FASMTGTKTTFAITLEYAASIIALVAIFKSFFGHYLGTLEGLNGLVLKFGYKGDKTKVSL
GKLNTISMIFIMGSTWVVAYANPNILDLIEAMGAPIIASLLCLLPMYAIRKAPSLAKYRG
RLDNVFVTVIGLLTILNIVYKLF