Protein Info for KEDOAH_09295 in Escherichia coli ECRC99

Name: fepD
Annotation: ABC-type Fe3+-siderophore transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 319 to 339 (21 residues), see Phobius details PF01032: FecCD" amino acids 34 to 339 (306 residues), 260.2 bits, see alignment E=1.1e-81

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to ecs:ECs3914)

Predicted SEED Role

"putative permease of ferrichrome ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>KEDOAH_09295 ABC-type Fe3+-siderophore transport system, permease component (Escherichia coli ECRC99)
MNVGLRPLRVGKFSTLVRPKNLVLLGGLFLFAVGILIFGLMHGSFFVPASEVGRALFAPE
NVSTDARYIVQDIRLPRVIMALLCGAMLGMAGAAMQSIARNGLADPGLIGVKEGCSVAVL
WLIFQFPMLGMFWRPVAGLAGGLLVALIVIFCAREISRPRFVLIGIGVSWFFAAGIGVFM
TTADVRDVQTALMWLSGSLHAANWMLVGISACWMLPAALLLLFTARTADIALLGHQVATG
LGVNSSRLALLRVAAPIILTAVCVSCVGNIGFVGLIAPHISRFILRGGQTTLLLGSAVSG
ALLVILADSIGRLAFLPLQLPAGIIISLIGGPFFLLLLWQRRNSF