Protein Info for KEDOAH_09150 in Escherichia coli ECRC99

Name: dLH
Annotation: dienelactone hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01738: DLH
  • amino acids 85 to 293 (209 residues), 167.7 bits, E=5.6e-53
• PF02129: Peptidase_S15
  • amino acids 160 to 211 (52 residues), 26.5 bits, 1e-09
• PF08840: BAAT_C
  • amino acids 163 to 228 (66 residues), 22.1 bits, E=3e-08

Best Hits

KEGG orthology group: K01061, carboxymethylenebutenolidase [EC: 3.1.1.45] (inferred from 97% identity to ecq:ECED1_3650)

Predicted SEED Role

"Dienelactone hydrolase family"

MetaCyc Pathways

• 4-chlorocatechol degradation (2/5 steps found)
• 4,5-dichlorocatechol degradation (3/7 steps found)
• 3,4,6-trichlorocatechol degradation (4/9 steps found)
• 3-chlorocatechol degradation I (ortho) (1/5 steps found)
• 3-chlorocatechol degradation II (ortho) (1/5 steps found)
• 3,5-dichlorocatechol degradation (3/8 steps found)
• 1,4-dichlorobenzene degradation (3/9 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Fluorobenzoate degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.45

Use Curated BLAST to search for 3.1.1.45

Protein Sequence (295 amino acids)

>KEDOAH_09150 dienelactone hydrolase (Escherichia coli ECRC99)
MPRLTAKDFPQELLDYYDYYAHGKISKREFLNLAAKYAVGGMTALALFDLLKPNYALATQ
VEFTDPEIFAEYITYPSPNGHGEVRGYLVKPAKMSGKTPAVVVVHENRGLNPYIEDVARR
VAKAGYIALAPDGLNSVGGYPGNDDKGRELQQQVDPTKLMNDFFAAIEFMQRYPQATGKV
GITGFCYGGGVSNAAAVAYPELACAVPFYGRQAPTADVAKIEAPLLLHFAELDTRINEGW
PAYEAALKANNKVYEAYIYPGVNHGFHNDSTPRYDKSAADLAWQRTLKWFDKYLS