Protein Info for KEDOAH_08710 in Escherichia coli ECRC99

Name: scpC
Annotation: propionyl-CoA:succinate CoA transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02550: AcetylCoA_hydro
  • amino acids 1 to 213 (213 residues), 247.7 bits, E=1e-77
• TIGR03458: succinate CoA transferase
  • amino acids 4 to 490 (487 residues), 754.1 bits, E=3.1e-231
• PF13336: AcetylCoA_hyd_C
  • amino acids 317 to 461 (145 residues), 141.2 bits, E=2.6e-45

Best Hits

Swiss-Prot: 99% identical to SCPC_ECOLI: Propionyl-CoA:succinate CoA transferase (scpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b2920)

MetaCyc: 99% identical to propionyl-CoA:succinate CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-268 [EC: 2.8.3.27]

Predicted SEED Role

"Propionyl-CoA:succinyl-CoA transferase"

MetaCyc Pathways

• conversion of succinate to propanoate (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• pyruvate fermentation to propanoate I (5/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
• L-glutamate degradation VIII (to propanoate) (7/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.27

Protein Sequence (492 amino acids)

>KEDOAH_08710 propionyl-CoA:succinate CoA transferase (Escherichia coli ECRC99)
METQWTRMTADEAAEIIQHNDMVAFSGFTPAGSPKALPTAIARRANEQHEAKKPYQIRLL
TGASISAAADDVLSDADAVSWRAPYQTSSGLRKKINQGAVSFVDLHLSEVAQMVNYGFFG
DIDVAVIEASALAPDGRVWLTSGIGNAPTWLLRAKKVIIELNHYHDPRVAELADIVIPGA
PPRRNSVSIFHAMDRVGTRYVQIDPKKIVAVVETNLPDAGNMLDKQNPMCQQIADNVVTF
LLQEMAHGRIPPEFLPLQSGVGNINNAVMARLGENPEIPPFMMYSEVLQESVVHLLETGK
ISGASASSLTISADSLRKIYDNMDYFASRIVLRPQEISNNPEIIRRLGVIALNVGLEFDI
YGHANSTHVAGVDLMNGIGGSGDFERNAYLSIFMAPSIAKEGKISTVVPMCSHVDHNEHS
VKVIITEQGIADLRGLSPLQRARTIIDNCAHPMYRDYLHRYLENAPGGHIHHDLSHVFDL
HRNLIATGSMLG