Protein Info for KEDOAH_08525 in Escherichia coli ECRC99

Name: ygfT
Annotation: formate-dependent uric acid utilization protein YgfT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 53 to 137 (85 residues), 46.2 bits, E=2.3e-15
• PF12838: Fer4_7
  • amino acids 56 to 101 (46 residues), 30.9 bits, 1.7e-10
• PF00037: Fer4
  • amino acids 81 to 102 (22 residues), 27.9 bits, see alignment (E = 8e-10)
• PF12837: Fer4_6
  • amino acids 83 to 101 (19 residues), 27.1 bits, see alignment (E = 1.7e-09)
• TIGR01318: glutamate synthase, small subunit
  • amino acids 171 to 635 (465 residues), 847.8 bits, E=9.3e-260
• PF14691: Fer4_20
  • amino acids 188 to 298 (111 residues), 125.4 bits, E=5.4e-40
• PF07992: Pyr_redox_2
  • amino acids 312 to 623 (312 residues), 74.2 bits, E=6.8e-24
• PF00070: Pyr_redox
  • amino acids 312 to 383 (72 residues), 26.7 bits, E=3.5e-09
• PF03486: HI0933_like
  • amino acids 312 to 346 (35 residues), 23.7 bits, see alignment (E = 1.1e-08)
• PF01494: FAD_binding_3
  • amino acids 312 to 343 (32 residues), 25.3 bits, see alignment (E = 5e-09)
• PF13450: NAD_binding_8
  • amino acids 315 to 349 (35 residues), 34.1 bits, see alignment (E = 1.5e-11)

Best Hits

Swiss-Prot: 100% identical to YGFT_ECOLI: Uncharacterized protein YgfT (ygfT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ece:Z4225)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (639 amino acids)

>KEDOAH_08525 formate-dependent uric acid utilization protein YgfT (Escherichia coli ECRC99)
MNKFIAAEAAECIGCHACEIACAVAHNQENWPLSHSDFRPRIHVVGKGLAANPVACHHCN
NAPCVTACPVNALTFQSDSVQLDEQKCIGCKRCAIACPFGVVEMVDTIAQKCDLCNQRSS
GTQACIEVCPTQALRLMDDKGLQQIKVARQRKTAAGKASSDAQPSRSAALLPVNSRKGAD
KISASERKNHFGEIYCGLDPQQATYESDRCVYCAEKANCNWHCPLHNAIPDYIRLVQEGK
IIEAAELCHQTSSLPEICGRVCPQDRLCEGACTLKDHSGAVSIGNLERYITDTALAMGWR
PDVSKVVPRIEKVAVIGAGPAGLGCADILARAGVQVDVFDRHPEIGGMLTFGIPPFKLDK
TVLSQRREIFTAMGIDFHLNCEIGRDITFSDLTSEYDAVFIGVGTYGMMRADLPHEDAPG
VIQALPFLTAHTRQLMGLPESEEYPLTDVEGKRVVVLGGGDTTMDCLRTSIRLNAASVTC
AYRRDEVSMPGSRKEVVNAREEGVEFQFNVQPQYIACDEDGRLTAVGLIRTAMGEPGPDG
RRRPRPVAGSEFELPADVLIMAFGFQAHAMPWLQGSGIKLDKWGLIQTGDVGYLPTQTHL
KKVFAGGDAVHGADLVVTAMAAGRQAARDMLTLFDTKAS